privacyaiwhisperkitapple-siliconlocal-ai

Why Local AI Matters: How DropVox Transcribes Audio 100% Privately

How DropVox uses local AI (WhisperKit + Apple Neural Engine) for 100% private audio transcription on Mac. No cloud, no uploads.

Helsky Labs2026-02-079 min read

The Cloud AI Problem

Every time you use a cloud-based transcription service, a predictable sequence of events occurs. Your audio file travels from your computer to a data center, likely hundreds or thousands of miles away. There, it is processed by servers you do not own, managed by a company whose internal data practices you have no visibility into.

Most services promise your data is handled responsibly. Their privacy policies say things like "we may use your data to improve our services" or "data is retained for up to 30 days for quality assurance." What this means in practice is that your private conversations, voice messages, meeting recordings, and personal notes exist on someone else's infrastructure for an indeterminate period of time.

This is not theoretical risk. Cloud transcription services have experienced data breaches. Employees at major tech companies have been caught listening to user audio recordings. Legal subpoenas can compel companies to hand over stored data. And even without malicious intent, the simple fact that your audio exists on a remote server creates attack surface that would not exist if the audio never left your device.

For most casual use cases, people accept these tradeoffs without thinking about them. But consider what audio transcription actually involves: you are giving a service access to the raw content of your conversations. Not metadata, not timestamps, but the actual words people said in what they assumed was a private exchange.

How DropVox Works: Architecture of Private Transcription

[DropVox](https://dropvox.app) takes a fundamentally different approach. Instead of sending audio to the cloud, it runs the entire transcription pipeline locally on your Mac using two key technologies:

WhisperKit is an optimized implementation of OpenAI's Whisper speech recognition model, built specifically for Apple Silicon. It packages the AI model so it can run natively on your Mac's hardware without any server component.

Apple Neural Engine (ANE) is a dedicated chip built into every Apple Silicon Mac (M1 and later) designed specifically for machine learning workloads. When DropVox processes audio, it leverages this hardware to run inference at speeds that would have required a data center just a few years ago.

The result: when you drop an audio file into DropVox, it never touches a network connection. The audio goes from your file system directly into the WhisperKit model running on your Neural Engine, and text comes out the other side. The entire process happens in the same physical device sitting on your desk.

There is no server to breach because there is no server. There is no data retention policy to read because the data never leaves your control. There is no third-party access because no third party is involved.

The 5 AI Models Explained

DropVox offers five different WhisperKit model sizes, each representing a different point on the speed-versus-accuracy spectrum. Understanding which to use can significantly improve your experience.

Tiny (75MB)

The fastest option. The Tiny model downloads quickly and transcribes audio almost instantly. It works well for clear audio with minimal background noise, like voice messages recorded in quiet rooms. For casual transcription where speed matters more than catching every word perfectly, Tiny is surprisingly capable.

Best for: Quick voice messages, clear recordings, when you want results in seconds.

Base (142MB)

A step up in accuracy without a major speed penalty. The Base model handles slightly noisier audio better than Tiny and produces more coherent output for longer recordings. This is a good default for everyday use.

Best for: Daily voice message transcription, podcast notes, general-purpose use.

Small (484MB)

The sweet spot for most users. The Small model offers noticeably better accuracy than Base, particularly with accented speech, technical vocabulary, and moderate background noise. Transcription is still fast on Apple Silicon, typically completing within a few seconds for standard-length audio.

Best for: Professional conversations, multilingual audio, meeting recordings, anything where accuracy matters.

Medium (~1.5GB)

Near-perfect accuracy for most audio. The Medium model handles difficult conditions well: heavy accents, cross-talk, background music, and low-quality microphones. The tradeoff is a larger download and slightly longer processing time, though on modern Apple Silicon Macs the difference is measured in seconds rather than minutes.

Best for: Important recordings where you need reliable accuracy, noisy environments, professional transcription work.

Large (~3GB)

The highest quality model available. Large provides the best possible accuracy across all conditions and languages. It requires more storage and processing time, but for critical audio where every word matters, it is the right choice.

Best for: Legal recordings, medical dictation, archival transcription, anything where accuracy is non-negotiable.

How to Choose

For most people, Small is the right starting point. It balances accuracy and speed well for typical voice messages and recordings. Move up to Medium or Large when dealing with difficult audio or critical content. Use Tiny or Base when you need quick, rough transcriptions and can tolerate occasional errors.

You can switch models at any time in DropVox's Settings. The app downloads models on demand, so you only use storage for the models you actually choose.

Privacy Use Cases: Who Needs Local Transcription

Local transcription is not just for the privacy-conscious. Several professional and personal contexts make it effectively a requirement.

Healthcare

Medical professionals regularly dictate notes, record patient interactions (with consent), and transcribe clinical observations. In many jurisdictions, HIPAA and similar regulations create strict requirements around how patient data is handled. Uploading medical audio to a third-party cloud service introduces compliance complexity that local processing avoids entirely.

Legal

Attorney-client privilege is a cornerstone of legal practice. Lawyers who transcribe client conversations, depositions, or case notes using cloud services risk creating a record of privileged communications on third-party infrastructure. Local transcription keeps privileged content under the attorney's direct control.

Corporate

Trade secrets, strategic plans, financial discussions, and internal communications represent real competitive value. Companies that allow employees to upload meeting recordings to cloud transcription services are accepting a risk that many security teams would not approve if they understood it fully.

Journalism

Source protection is fundamental to journalism. Reporters who transcribe interviews with confidential sources using cloud services create a digital trail that could potentially be subpoenaed or breached. Local transcription protects both the journalist and the source.

Personal

Not every privacy need is professional. Private conversations with family, friends, and partners deserve the same protection. Voice messages often contain emotional, financial, or health-related content that people would not want stored on an external server.

Cloud vs. Local: A Direct Comparison

| Feature | Cloud Transcription | DropVox (Local) |

|---|---|---|

| Privacy | Audio uploaded to external servers | Audio never leaves your Mac |

| Internet required | Yes, always | No, works fully offline |

| Speed | Upload + processing + download | Instant local processing |

| Cost | $8-25/month subscription | $12.99 one-time |

| Account required | Yes | No |

| Data retention | Varies by provider (days to indefinite) | You control your own data |

| Accuracy | High (large server models) | High (WhisperKit, 5 model sizes) |

| Language support | Varies | 13 languages with auto-detection |

| Batch processing | Usually yes | One file at a time |

| Advanced features | Speaker diarization, timestamps | Focused on fast transcription |

The tradeoffs are real. Cloud services sometimes offer features like speaker identification and detailed timestamps that local tools may not. But for the core task of converting audio to text quickly and privately, local AI has caught up to and in many cases surpassed cloud alternatives.

The Trajectory of Local AI

What makes this moment interesting is the trajectory. Apple Silicon Macs get more capable every generation. The M4 chips handle AI workloads that would have strained the M1, and future chips will continue this trend. Meanwhile, model optimization techniques like those used by WhisperKit keep making models smaller and faster without sacrificing accuracy.

The gap between cloud and local AI quality is closing rapidly. In many practical scenarios, it has already closed. A Small or Medium WhisperKit model running on an M-series Mac produces transcriptions that are indistinguishable from cloud service output for standard audio.

This is why I built DropVox as part of [Helsky Labs](https://helsky-labs.com). The technology is ready for local-first AI tools that do not compromise on quality. [TokenCentric](https://tokencentric.app) follows the same philosophy for developers who want local-first credential management. The pattern is the same: powerful functionality that respects the user by keeping their data under their control.

Conclusion

The question is not whether local AI transcription is good enough. It is. The question is why you would upload private audio to a cloud service when you no longer have to.

DropVox exists because privacy and convenience should not be opposing forces. With WhisperKit and Apple Silicon, they are not. Your audio stays on your Mac, the transcription happens in seconds, and nobody else is involved.

That is how transcription should work. Download DropVox from [dropvox.app](https://dropvox.app) and see for yourself.

Ready to Try DropVox?

Free, private, and offline audio transcription for Mac.

Download DropVox